N-(1-D-carboxylethyl)-L-norvaline dehydrogenase (a.100.1.5)


SCOP classification
 
Class: All alpha proteins
Fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
Superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
Family: N-(1-D-carboxylethyl)-L-norvaline dehydrogenase



Orphan Member
 
Domain: d1bg6a1 of protein: N-(1-D-carboxylethyl)-L-norvaline dehydrogenase from Species: Arthrobacter, strain 1c [TaxId: 1663]




>1bg6a1(a.100.1.5)
NVLHTSLTNVNAVMHPLPTLLNAARCESGTPFQYYLEGITPSVGSLAEKVDAERIAIAKAFDLNVPSVCEWYPATIYEAVQGNPAYRGIAGPINLNTRYFFEDVSTGLVPLSELGRAVNVPTPLIDAVLDLISSLIDTDFRKEGRTLEKLGLSGLTAAGIRSAVE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)