Mannitol 2-dehydrogenase (a.100.1.9)


SCOP classification
 
Class: All alpha proteins
Fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
Superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
Family: Mannitol 2-dehydrogenase



Orphan Member
 
Domain: d1m2wb3 of protein: Mannitol 2-dehydrogenase from Species: Pseudomonas fluorescens [TaxId: 294]




>1lj8a3(a.100.1.9)
DVTPYEEMKIGLLNGSHLALTYLGFLKGYRFVHETMNDPLFVAYMRAYMDLDVTPNLAPVPGIDLTDYKQTLVDRFSNQAIADQLERVCSDGSSKFPKFTVPTINRLIADGRETERAALVVAAWALYLKGVDENGVSYTIPDPRAEFCQGLVSDDALISQRLLAVEEIFGTAIPNSPEFVAAFERCYGSLRDNGVTTTLKHLLKKP

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)