Alginate lyase A1-III (a.102.3.1)


SCOP classification
 
Class: All alpha proteins
Fold: alpha/alpha toroid
Superfamily: Chondroitin AC/alginate lyase
Family: Alginate lyase A1-III



Orphan Member
 
Domain: d4f13b_ of protein: Alginate lyase A1-III from Species: Sphingomonas sp., A1 [TaxId: 28214]




>1qaza_(a.102.3.1)
GSHPFDQAVVKDPTASYVDVKARRTFLQSGQLDDRLKAALPKEYDCTTEATPNPQQGEMVIPRRYLSGNHGPVNPDYEPVVTLYRDFEKISATLGNLYVATGKPVYATCLLNMLDKWAKADALLNYDPKSQSWYQVEWSAATAAFALSTMMAEPNVDTAQRERVVKWLNRVARHQTSFPGGDTSCCNNHSYWRGQEATIIGVISKDDELFRWGLGRYVQAMGLINEDGSFVHEMTRHEQSLHYQNYAMLPLTMIAETASRQGIDLYAYKENGRDIHSARKFVFAAVKNPDLIKKYASEPQDTRAFKPGRGDLNWIEYQRARFGFADELGFMTVPIFDPRTGGSATLLAYKP

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)