Kix domain of CBP (creb binding protein) (a.12.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Kix domain of CBP (creb binding protein)
Superfamily: Kix domain of CBP (creb binding protein)
Family: Kix domain of CBP (creb binding protein)



Orphan Member
 
Domain: d4i9oa_ of protein: Kix domain of CBP (creb binding protein) from Species: Mouse (Mus musculus) [TaxId: 10090]




>1kdxa_(a.12.1.1)
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)