monomeric chorismate mutase (a.130.1.3)


SCOP classification
 
Class: All alpha proteins
Fold: Chorismate mutase II
Superfamily: Chorismate mutase II
Family: monomeric chorismate mutase



Orphan Member
 
Domain: d2gtvx1 of protein: Chorismate mutase-like protein MJ0246 from Species: Methanococcus jannaschii [TaxId: 2190]




>2gtvx1(a.130.1.3)
MIEKLAEIRKKIDEIDNKILKARWPWAEKLIAERNSLAKDVAEIKNQLGIPINDPEREKYIYDRIRKLCKEHNVDENIGIKIFQRLIEHNKAL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)