Secreted chorismate mutase-like (a.130.1.4)


SCOP classification
 
Class: All alpha proteins
Fold: Chorismate mutase II
Superfamily: Chorismate mutase II
Family: Secreted chorismate mutase-like



Orphan Member
 
Domain: d2fp2b_ of protein: Secreted chorismate mutase from Species: Mycobacterium tuberculosis [TaxId: 1773]




>2fp1b1(a.130.1.4)
TSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNPASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRALTTATQSYCQALPPA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)