automated matches (a.137.13.0)


SCOP classification
 
Class: All alpha proteins
Fold: Non-globular all-alpha subunits of globular proteins
Superfamily: RelB-like
Family: automated matches



Orphan Member
 
Domain: d1wmid_ of protein: automated matches from Species: Pyrococcus horikoshii [TaxId: 70601]




>d1wmid_|a.137.13.0
GDVLKELERLKVEIQRLEAMLMPEERDEDITEEEIAELLELARDEDPENWIDAEELPEPE
D

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)