PRP4-like (a.140.6.1)


SCOP classification
 
Class: All alpha proteins
Fold: LEM/SAP HeH motif
Superfamily: PRP4-like
Family: PRP4-like



Orphan Member
 
Domain: d2dk4a1 of protein: Pre-mRNA-splicing factor 18 from Species: Human (Homo sapiens) [TaxId: 9606]




>d2dk4a1|a.140.6.1
TSSNPVLELELAEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEV
NKG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)