PF0609-like (a.149.1.2)


SCOP classification
 
Class: All alpha proteins
Fold: RNase III domain-like
Superfamily: RNase III domain-like
Family: PF0609-like



Orphan Member
 
Domain: d1ztdb_ of protein: automated matches from Species: Pyrococcus furiosus [TaxId: 2261]




>1ztdb1(a.149.1.2)
EIDKGLAKFGDSLINFLYSLALTEFLGKPTGDRVPNASLAIALELTGLSKNLRRVDKHAKGDYAEALIAKAWLMGLISEREAVEIIKKNLYPEVLDFSKKKEAIGRALAPLLVIISERLYSSQV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)