TAF(II)230 TBP-binding fragment (a.15.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: TAF(II)230 TBP-binding fragment
Superfamily: TAF(II)230 TBP-binding fragment
Family: TAF(II)230 TBP-binding fragment



Orphan Member
 
Domain: d1tbaa_ of protein: TAF(II)230 TBP-binding fragment from Species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]




>1tbaa_(a.15.1.1)
EGSIGNGLDLTGILFGNIDSEGRLLQDDDGEGRGGTGFDAELRENIGSLSKLGLDSMLLEVIDLKEA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)