p8-MTCP1 (a.17.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Cysteine alpha-hairpin motif
Superfamily: Cysteine alpha-hairpin motif
Family: p8-MTCP1



Orphan Member
 
Domain: d2hp8a_ of protein: p8-MTCP1 from Species: Human (Homo sapiens) [TaxId: 9606]




>2hp8a_(a.17.1.1)
MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)