COX17-like (a.17.1.2)


SCOP classification
 
Class: All alpha proteins
Fold: Cysteine alpha-hairpin motif
Superfamily: Cysteine alpha-hairpin motif
Family: COX17-like



Orphan Member
 
Domain: d1z2ga_ of protein: automated matches from Species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]




>1u97a_(a.17.1.2)
MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)