Orange carotenoid protein, N-terminal domain (a.175.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Orange carotenoid protein, N-terminal domain
Superfamily: Orange carotenoid protein, N-terminal domain
Family: Orange carotenoid protein, N-terminal domain



Orphan Member
 
Domain: d1m98b1 of protein: Orange carotenoid protein, N-terminal domain from Species: Arthrospira maxima [TaxId: 129910]




>1m98b1(a.175.1.1)
PFTIDTARSIFPETLAADVVPATIARFKQLSAEDQLALIWFAYLEMGKTITIAAPGAANMQFAENTLQEIRQMTPLQQTQAMCDLANRTDTPICRTYASWSPNIKLGFWYELGRFMDQGLVAPIPEGYKLSANANAILVTIQGIDPGQQITVLRNCVVDMGFDTSKLGSYQRVA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)