Replisome organizer (g39p helicase loader/inhibitor protein) (a.179.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Replisome organizer (g39p helicase loader/inhibitor protein)
Superfamily: Replisome organizer (g39p helicase loader/inhibitor protein)
Family: Replisome organizer (g39p helicase loader/inhibitor protein)



Orphan Member
 
Domain: d1no1c_ of protein: Replisome organizer (g39p helicase loader/inhibitor protein) from Species: Bacteriophage Spp1 [TaxId: 10724]




>1no1c_(a.179.1.1)
MIEKDVVQILKAVSEFYPGRFQPDDLKGTVKAWHRVLAEYELEEIMNNLTDYAKVNKFPPTVSDLLK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)