T4 endonuclease V (a.18.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: T4 endonuclease V
Superfamily: T4 endonuclease V
Family: T4 endonuclease V



Orphan Member
 
Domain: d2fccb_ of protein: T4 endonuclease V from Species: Bacteriophage T4 [TaxId: 10665]




>2enda_(a.18.1.1)
TRINLTLVSELADQHLMAEYRELPRVFGAVRKHVANGKRVRDFKISPTFILGAGHVTFFYDKLEFLRKRQIELIAECLKRGFNIKDTTVQDISDIPQEFRGDYIPHEASIAISQARLDEKIAQRPTWYKYYGKAIYA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)