GatB/YqeY domain (a.182.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: GatB/YqeY motif
Superfamily: GatB/YqeY motif
Family: GatB/YqeY domain



Orphan Member
 
Domain: d1ng6a_ of protein: Hypothetical protein YqeY from Species: Bacillus subtilis [TaxId: 1423]




>1ng6a_(a.182.1.1)
MSLLERLNQDMKLYMKNREKDKLTVVRMVKASLQNEAIKLKKDSLTEDEELTVLSRELKQRKDSLQEFSNANRLDLVDKVQKELDILEVYLPEQLSEEELRTIVNETIAEVGASSKADMGKVMGAIMPKVKGKADGSLINKLVSSQLS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)