N-terminal domain of adenylylcyclase associated protein, CAP (a.192.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: N-terminal domain of adenylylcyclase associated protein, CAP
Superfamily: N-terminal domain of adenylylcyclase associated protein, CAP
Family: N-terminal domain of adenylylcyclase associated protein, CAP



Orphan Member
 
Domain: d1tjfb_ of protein: N-terminal domain of adenylylcyclase associated protein, CAP from Species: Slime mold (Dictyostelium discoideum) [TaxId: 44689]




>1s0pb_(a.192.1.1)
SVKEFQNLVDQHITPFVALSKKLAPEVGNQVEQLVKAIDAEKALINTASQSKKPSQETLLELIKPLNNFAAEVGKIRDSNRSSKFFNNLSAISESIGFLSWVVVEPTPGPHVAEMRGSAEFYTNRILKEFKGVNQDQVDWVSNYVNFLKDLEKYIKQYHTTGLTWNPKGGDAKSAT

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)