GRIP domain (a.193.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: GRIP domain
Superfamily: GRIP domain
Family: GRIP domain



Orphan Member
 
Domain: d1upth_ of protein: Golgi autoantigen, golgin-245 from Species: Human (Homo sapiens) [TaxId: 9606]




>1upth_(a.193.1.1)
GEPTEFEYLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDARL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)