ISY1 N-terminal domain-like (a.2.15.1)


SCOP classification
 
Class: All alpha proteins
Fold: Long alpha-hairpin
Superfamily: ISY1 domain-like
Family: ISY1 N-terminal domain-like



Orphan Member
 
Domain: d1x4ta1 of protein: Pre-mRNA-splicing factor ISY1 homolog from Species: Mouse (Mus musculus) [TaxId: 10090]




>1x4ta1(a.2.15.1)
GKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)