VPS28 N-terminal domain (a.2.17.2)


SCOP classification
 
Class: All alpha proteins
Fold: Long alpha-hairpin
Superfamily: Endosomal sorting complex assembly domain
Family: VPS28 N-terminal domain



Orphan Member
 
Domain: d2p22b_ of protein: automated matches from Species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]




>2f6md1(a.2.17.2)
QLFHDEVPLFDNSITSKDKEVIETLSEIYSIVITLDHVEKAYLKDSIDDTQYTNTVDKLLKQFKVYLNSQNKEEINKHFQSIEAFADTYNITASNAITRLER

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)