Hypothetical protein YhaI (a.219.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Hypothetical protein YhaI
Superfamily: Hypothetical protein YhaI
Family: Hypothetical protein YhaI



Orphan Member
 
Domain: d1sedc_ of protein: Hypothetical protein YhaI from Species: Bacillus subtilis [TaxId: 1423]




>1sedb_(a.219.1.1)
MDHRIERLEYYIQLLVKTVDMDRYPFYALLIDKGLSKEEGEAVMRICDELSEELATQKAQGFVTFDKLLALFAGQLNEKLDVHETIFALYEQGLYQELMEVFIDIMKHFD

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)