Her-1 (a.226.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Her-1
Superfamily: Her-1
Family: Her-1



Orphan Member
 
Domain: d1szhb_ of protein: Her-1 from Species: Nematode (Caenorhabditis elegans) [TaxId: 6239]




>1szhb_(a.226.1.1)
LTKELIKDAAEKCCTRNRQECCIEIMKFGTPIRCGYDRDPKLPGYVYKCLQNVLFAKEPKKKINLDDSVCCSVFGNDQEDSGRRCENRCKNLMTSPSIDAATRLDSIKSCSLLDNVLYKCFEKCRSLRKDGIKIEVLQFEEYC

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)