Hypothetical protein YqbG (a.229.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Hypothetical protein YqbG
Superfamily: Hypothetical protein YqbG
Family: Hypothetical protein YqbG



Orphan Member
 
Domain: d1ztsa_ of protein: Hypothetical protein YqbG from Species: Bacillus subtilis [TaxId: 1423]




>1xn8a_(a.229.1.1)
MLLITPDELKSYSVFESVKTRPDELLKQDILEATADIILKVGHDFSDAEYIPLPETVRLALLKLSQFYALINGDESIIKGYTTEKIGDYSYTLGDGSSLQKPDVYALIKDYVKPADPDLEGIEAKVRMRSI

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)