HSC20 (HSCB), C-terminal oligomerisation domain (a.23.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Open three-helical up-and-down bundle
Superfamily: HSC20 (HSCB), C-terminal oligomerisation domain
Family: HSC20 (HSCB), C-terminal oligomerisation domain



Orphan Member
 
Domain: d1fpoc2 of protein: HSC20 (HSCB), C-terminal oligomerisation domain from Species: Escherichia coli [TaxId: 562]




>1fpoc2(a.23.1.1)
FDLASEQHTVRDTAFLMEQLELREELDEIEQAKDEARLESFIKRVKKMFDTRHQLMVEQLDNETWDAAADTCRKLRFLDKLRSSAEQLEEKLLDF

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)