EspA-like (a.231.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: EspA/CesA-like
Superfamily: EspA/CesA-like
Family: EspA-like



Orphan Member
 
Domain: d1xoua_ of protein: Secreted protein EspA from Species: Escherichia coli [TaxId: 562]




>1xoua_(a.231.1.1)
DVIDLFNKLGVFQAAILMFAYMYQAQSDLNLTTTVNNSQLEIQQMSNTLNLLTSARSDMQSLQYRTISGISL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)