Hypothetical protein MPN330 (a.234.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Hypothetical protein MPN330
Superfamily: Hypothetical protein MPN330
Family: Hypothetical protein MPN330



Orphan Member
 
Domain: d1td6a_ of protein: Hypothetical protein MPN330 from Species: Mycoplasma pneumoniae [TaxId: 2104]




>1td6a_(a.234.1.1)
PNQFVNHLSALKKHFASYKELREAFNDYHKHNGDELTTFFLHQFDKVMELVKQKDFKTAQSRCEEELAAPYLPKPLVSFFQSLLQLVNHDLLEQQNAALASLPAAKIIELVLQDYPNKLNMIHYLLPKTKAFVKPHLLQRLQFVLTDSELLELKRFSFFQALNQIPGFQGEQVEYFNSKLKQKFTLTLGEFEIAQQPDAKAYFEQLITQIQQLFLKEPVNAEFANEIIDAFLVSYFPLHPPVPLAQLAAKIYEYVSQIVLNEAVNLKDELIKLIVHTLYEQLDRPV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)