Phosphorelay protein luxU (a.24.10.5)


SCOP classification
 
Class: All alpha proteins
Fold: Four-helical up-and-down bundle
Superfamily: Histidine-containing phosphotransfer domain, HPT domain
Family: Phosphorelay protein luxU



Orphan Member
 
Domain: d1y6da_ of protein: Phosphorelay protein luxU from Species: Vibrio harveyi [TaxId: 669]




>1y6da_(a.24.10.5)
MNTDVLNQQKIEELSAEIGSDNVPVLLDIFLGEMDSYIGTLTELQGSEQLLYLKEISHALKSSAASFGADRLCERAIAIDKKAKANQLQEQGMETSEMLALLHITRDAYRSWTN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)