FAT domain of focal adhesion kinase (a.24.14.1)


SCOP classification
 
Class: All alpha proteins
Fold: Four-helical up-and-down bundle
Superfamily: FAT domain of focal adhesion kinase
Family: FAT domain of focal adhesion kinase



Orphan Member
 
Domain: d1k40a_ of protein: FAT domain of focal adhesion kinase from Species: Mouse (Mus musculus) [TaxId: 10090]




>1k04a_(a.24.14.1)
EISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)