automated matches (a.24.16.0)


SCOP classification
 
Class: All alpha proteins
Fold: Four-helical up-and-down bundle
Superfamily: Nucleotidyltransferase substrate binding subunit/domain
Family: automated matches



Orphan Member
 
Domain: d1wola_ of protein: automated matches from Species: Sulfolobus tokodaii [TaxId: 273063]




>d1wola_|a.24.16.0
MKRVEDWIKQAERDLEEARYAKSGGYYELACFLSQQCAEKAVKGLLQFQGIEKRGHSISH
LLTNPPADILQCATFLDKQYTPSRYPDVYYEGAPYEYYTERDADECINCAIRILNWVKGQ
IK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)