automated matches (a.24.29.0)


SCOP classification
 
Class: All alpha proteins
Fold: Four-helical up-and-down bundle
Superfamily: TM1646-like
Family: automated matches



Orphan Member
 
Domain: d2qupa_ of protein: automated matches from Species: Bacillus halodurans [TaxId: 86665]




>d2qupa_|a.24.29.0
GVSFSEVMGKQRDEKAYERLQALMSKIDDQGKLLSETRTIEELRKYKELVKEFVGDAVEL
GLRLEERNRRGRTKIYKIVKEVDRKLLDLTDAVLAKEKKGLDILNMVGEIKGLLINIYA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)