TM1646-like (a.24.29.1)


SCOP classification
 
Class: All alpha proteins
Fold: Four-helical up-and-down bundle
Superfamily: TM1646-like
Family: TM1646-like



Orphan Member
 
Domain: d2p61a1 of protein: Hypothetical protein TM1646 from Species: Thermotoga maritima [TaxId: 2336]




>d2p61a1|a.24.29.1
EFFDILEDVKEDHFEKLLEEAVEEVIDSGNELVRSPTPSNLKRYKNAIKEFLKLIEKKIY
KLNSGRARLHLVVEEVNEKLMDLTEKIMKNEWQTINLAARIEEINGLILNLYR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)