YfmB-like (a.249.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: YfmB-like
Superfamily: YfmB-like
Family: YfmB-like



Orphan Member
 
Domain: d2eucb_ of protein: Hypothetical protein YfmB from Species: Bacillus subtilis [TaxId: 1423]




>2eucb1(a.249.1.1)
MQYFSPEQQYNAWIVSDLVKQIFHKRAGCSPGIHELAVFAEEHFHIDIDFVFSIIMNIGDIEFALTDEIEKKLSGYLSTLLPYVTADMFETSKANAHAFLSAAYHLFV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)