Phage replication organizer domain (a.251.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Phage replication organizer domain
Superfamily: Phage replication organizer domain
Family: Phage replication organizer domain



Orphan Member
 
Domain: d2c5rf_ of protein: automated matches from Species: Bacillus phage [TaxId: 10756]




>2bnkb1(a.251.1.1)
NLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYRGSL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)