CSE2-like (a.252.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Mediator hinge subcomplex-like
Superfamily: Mediator hinge subcomplex-like
Family: CSE2-like



Orphan Member
 
Domain: d1ykhb1 of protein: RNA polymerase II holoenzyme component SRB7 (MED21) from Species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]




>1ykhb1(a.252.1.1)
TDRMTQLQICLDQMTEQFCATLNYIDKNHGFEVVPPEEFSNTIDELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLMRHVDSMIEDFV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)