RUN domain (a.256.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: RUN domain-like
Superfamily: RUN domain-like
Family: RUN domain



Orphan Member
 
Domain: d2dwka_ of protein: automated matches from Species: Mouse (Mus musculus) [TaxId: 10090]




>2cxfa1(a.256.1.1)
MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)