SipA N-terminal domain-like (a.257.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: SipA N-terminal domain-like
Superfamily: SipA N-terminal domain-like
Family: SipA N-terminal domain-like



Orphan Member
 
Domain: d2fm9a1 of protein: Cell invasion protein SipA, N-terminal domain from Species: Salmonella typhimurium [TaxId: 90371]




>2fm9a1(a.257.1.1)
PQLEDFPALIKQASLDALFKCGKDAEALKEVFTNSNNVAGKKAIMEFAGLFRSALNATSDSPEAKTLLMKVGAEYTAQIIKDGLKEKSAFGPWLPETKKAEAKLENLEKQLLDIIKNNTGGELSKLSTNLVMQEVMPYIASCIEHNFGCTLDPLTRSNLTHLVDKAAAKAVEALDMCHQKHLEMQTLIPLLLRNVFAQIPA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)