YidB-like (a.259.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: YidB-like
Superfamily: YidB-like
Family: YidB-like



Orphan Member
 
Domain: d1z67a1 of protein: Hypothetical protein YidB from Species: Shigella flexneri [TaxId: 623]




>1z67a1(a.259.1.1)
LFDEVVGAFLKGDAGKYQAILSWVEEQGGIQVLLEKLQSGGLGAILSTWLSNQQRNQSVSGEQLESALGTNAVSDLGQKLGVDTSTASSLLAEQLPKIIDALSPQGEVQANNDLLSAGMELLKGKLF

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)