DnaD domain (a.275.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: DnaD domain-like
Superfamily: DnaD domain-like
Family: DnaD domain



Orphan Member
 
Domain: d2i5ua1 of protein: Uncaracterized protein EF2839 from Species: Enterococcus faecalis [TaxId: 1351]




>d2i5ua1|a.275.1.1
IRSIWENNGFGLSSKTTDFDYWISDFEKIGASQKEAEQLIVKAIEIAIDANARNYNYINA
ILKDWEQRGFKS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)