RPA2825-like (a.282.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: RPA2825-like
Superfamily: RPA2825-like
Family: RPA2825-like



Orphan Member
 
Domain: d2gqba1 of protein: Hypothetical protein RPA2825 from Species: Rhodopseudomonas palustris [TaxId: 1076]




>d2gqba1|a.282.1.1
MSIFGKIMSAIFGDSAAASPGGAQAPATTGAAGTAPTAPQPTAAPSIDVAPILDKAVKAK
GEKLEWRTSIVDLMKALDIDSSLSARKELAKELGYSGDMNDSASMNIWLHKQVMSKLVAN
GGKLPPEIKH

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)