PSPTO4464-like (a.290.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: PSPTO4464-like
Superfamily: PSPTO4464-like
Family: PSPTO4464-like



Orphan Member
 
Domain: d2p0ta1 of protein: Uncharacterized protein PSPTO4464 from Species: Pseudomonas syringae pv. tomato [TaxId: 323]




>d2p0ta1|a.290.1.1
LHALVDLGERLTTLKADVLAKLPLTDALRKALAEAPKHTANIARKRHILFIGKLRDQDQE
AILVLLDQLDASTRQYNERFHNLERWRDRLIAGDDADLEKFVIEYPDADRQQLRSLIRQA
QHEVARNKPPATSRKIFKYIRELDELQ

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)