NE0471 C-terminal domain-like (a.35.1.10)


SCOP classification
 
Class: All alpha proteins
Fold: lambda repressor-like DNA-binding domains
Superfamily: lambda repressor-like DNA-binding domains
Family: NE0471 C-terminal domain-like



Orphan Member
 
Domain: d2auwb1 of protein: Hypothetical protein NE0471 C-terminal domain from Species: Nitrosomonas europaea [TaxId: 915]




>2auwb1(a.35.1.10)
VSHEMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGWEATRPETKTLPRTLP

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)