EDF1-like (a.35.1.12)


SCOP classification
 
Class: All alpha proteins
Fold: lambda repressor-like DNA-binding domains
Superfamily: lambda repressor-like DNA-binding domains
Family: EDF1-like



Orphan Member
 
Domain: d1x57a1 of protein: Endothelial differentiation-related factor 1, EDF1 from Species: Human (Homo sapiens) [TaxId: 9606]




>1x57a1(a.35.1.12)
DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)