Hypothetical protein MTH865 (a.39.4.1)


SCOP classification
 
Class: All alpha proteins
Fold: EF Hand-like
Superfamily: Hypothetical protein MTH865
Family: Hypothetical protein MTH865



Orphan Member
 
Domain: d1iioa_ of protein: Hypothetical protein MTH865 from Species: Methanobacterium thermoautotrophicum [TaxId: 145262]




>1iioa_(a.39.4.1)
GSHMKMGVKEDIRGQIIGALAGADFPINSPEELMAALPNGPDTTCKSGDVELKASDAGQVLTADDFPFKSAEEVADTIVNKAGL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)