N-terminal domain of Bacillus PurR (a.4.5.40)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: N-terminal domain of Bacillus PurR



Orphan Member
 
Domain: d1p4ad1 of protein: N-terminal domain of Bacillus PurR from Species: Bacillus subtilis [TaxId: 1423]




>1o57d1(a.4.5.40)
KFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)