Transcription factor E/IIe-alpha, N-terminal domain (a.4.5.41)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: Transcription factor E/IIe-alpha, N-terminal domain



Orphan Member
 
Domain: d1q1ha_ of protein: Transcription factor E/IIe-alpha, N-terminal domain from Species: Sulfolobus solfataricus [TaxId: 2287]




>1q1ha_(a.4.5.41)
MVNAEDLFINLAKSLLGDDVIDVLRILLDKGTEMTDEEIANQLNIKVNDVRKKLNLLEEQGFVSYRKTRSGWFIYYWKPNIDQIN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)