FUR-like (a.4.5.42)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: FUR-like



Orphan Member
 
Domain: d1mzba_ of protein: Ferric uptake regulation protein, FUR from Species: Pseudomonas aeruginosa [TaxId: 287]




>1mzba_(a.4.5.42)
MVENSELRKAGLKVTLPRVKILQMLDSAQRHMSAEDVYKALMEAGEDVGLATVYRVLTQFEAAGLVVRHNFDGGHAVFELADSGHHDHMVCVDTGEVIEFMDAEIEKRQKEIVRERGFELVDHNLVLYVRKKK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)