Archaeal DNA-binding protein (a.4.5.49)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: Archaeal DNA-binding protein



Orphan Member
 
Domain: d1xsxb_ of protein: Sso10a (SSO10449) from Species: Sulfolobus solfataricus [TaxId: 2287]




>1r7ja_(a.4.5.49)
KKSKLEIIQAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEGKQYMLTKKGEELLEDIRKFNEMRKNMDQLKEKINSVLS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)