Heat-inducible transcription repressor HrcA, N-terminal domain (a.4.5.51)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: Heat-inducible transcription repressor HrcA, N-terminal domain



Orphan Member
 
Domain: d1stzc1 of protein: Heat-inducible transcription repressor HrcA, N-terminal domain from Species: Thermotoga maritima [TaxId: 2336]




>1stzc1(a.4.5.51)
ALKKLNDRQRKVLYCIVREYIENKKPVSSQRVLEVSNIEFSSATIRNDMKKLEYLGYIYQPHTSAGRIPTDKGLRFYYEEMLKIS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)