Eukaryotic translation initiation factor 3 subunit 12, eIF3k, C-terminal domain (a.4.5.53)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: Eukaryotic translation initiation factor 3 subunit 12, eIF3k, C-terminal domain



Orphan Member
 
Domain: d1rz4a1 of protein: Eukaryotic translation initiation factor 3 subunit 12, eIF3k, C-terminal domain from Species: Human (Homo sapiens) [TaxId: 9606]




>1rz4a1(a.4.5.53)
TGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADEQIFICSQEESIKPKNIVEKIDFDSVSSIMAS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)