Rio2 serine protein kinase N-terminal domain (a.4.5.56)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: Rio2 serine protein kinase N-terminal domain



Orphan Member
 
Domain: d1zara1 of protein: Rio2 serine protein kinase N-terminal domain from Species: Archaeoglobus fulgidus [TaxId: 2234]




>1zara1(a.4.5.56)
NIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)